Sequence :

Length  206
Residues  MKLFGFPLKEELVASSSSSVAVAVVVNNDDDGDDHYHECHYCGRQFSNSQALGGHQNAHKRERKQARLAHFNYLQLQHQHHSSSSKAAASTTLDHHLQAARHGSPSTINNNNNNNNNIHHPAIISGSGGCYYGAGGSDGWSIHSTPNHHHQFPTTTSLYPCGTRGTSDDHVLLQTPSYPHQYDHHHLDLNLTLACSSNNNNHVFKQ
MD5 Checksum  5322882b75294188b4995ea6a57447c8
USDA
InterMine logo
The Legume Information System (LIS) is a research project of the USDA-ARS:Corn Insects and Crop Genetics Research in Ames, IA.
PhaseolusMine | CicerMine | VignaMine | LupinMine | ArachisMine | SoyMine | MedicMine | LegumeMine
InterMine © 2002 - 2020 Department of Genetics, University of Cambridge, Downing Street, Cambridge CB2 3EH, United Kingdom